PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g046330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 600aa    MW: 65850.1 Da    PI: 10.042
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g046330.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3604.2e-19105199199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++++++++r +lp +f++++g++k++  ++tl  + g +W+  l+ r   g++vl+kGWk+Fv+angL +g +++++ ++ ++++++++
  Csa16g046330.1 105 FVTLTLTHNNFRKCRQYLPLSFLRKNGLDKPG--MITLLGKAGMKWRASLK-REANGSMVLGKGWKDFVNANGLTSGISFTLEAIS-EKGTPMLS 195
                     67788899*********************766..8***************4.5555569************************998.88999999 PP

                     EE-S CS
              B3  96 vfrk 99 
                     +f++
  Csa16g046330.1 196 LFST 199
                     9986 PP

2B346.66.3e-15221309799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ++ +l ++r +lp +f++++g++k++   +tl  e+g +We +l  r+k g + l+kGWk+F +an +k g+++++k +  ++++++++++++
  Csa16g046330.1 221 THTNLIKSRQYLPLSFTRANGLDKPG--LITLVGEDGAKWEANL-LRGKTGIMCLGKGWKHFSRANSIKCGESFTLKAIL-ENGTPMLSLCST 309
                     4555566789*************877..7***************.566666799***********************776.889999999986 PP

3B347.82.6e-15361455199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++d+l +gr +lp +f++e+g++k++  ++ l  ++g +We ++  r+k g + +++GWk+F+ a gLk+g++++++ +  ++++++++
  Csa16g046330.1 361 FVTLTLRHDNLITGRRYLPFSFTRENGLDKPG--KINLIGKDGTKWEANI-GRGKTGVMCIGEGWKDFAIASGLKSGESFTLEAIM-ENGTPMLS 451
                     667778899999*****************777..7***************.455555599***********************876.88999999 PP

                     EE-S CS
              B3  96 vfrk 99 
                     +f++
  Csa16g046330.1 452 LFST 455
                     9986 PP

4B347.72.7e-15506586387
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     + ++++   + + l++p +f++++g++k +  ++t+  ++  +   ++    k+g + l++GWk+F++ang+k gD+++++ + +
  Csa16g046330.1 506 TLTLTPEDVSDCKLIIPSQFMKANGINKLG--KITILGQHRMKCFAYI--LSKDGFVALGSGWKGFCEANGVKIGDSFTLECIVN 586
                     5555666667788************99766..7999999988887777..888999************************97654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508638.233165IPR003340B3 DNA binding domain
SMARTSM010191.3166IPR003340B3 DNA binding domain
SuperFamilySSF1019367.85E-73065IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.6E-73065IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-1999202IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-20101198IPR015300DNA-binding pseudobarrel domain
CDDcd100171.74E-16104198No hitNo description
PfamPF023628.6E-19105199IPR003340B3 DNA binding domain
SMARTSM010191.2E-27105200IPR003340B3 DNA binding domain
PROSITE profilePS5086314.804105200IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-15205317IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-17214310IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.267215310IPR003340B3 DNA binding domain
SMARTSM010192.6E-22215310IPR003340B3 DNA binding domain
PfamPF023623.0E-14219309IPR003340B3 DNA binding domain
CDDcd100174.68E-15219308No hitNo description
Gene3DG3DSA:2.40.330.106.7E-14351453IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.61E-14358448IPR015300DNA-binding pseudobarrel domain
CDDcd100171.93E-15360454No hitNo description
PfamPF023623.3E-14361455IPR003340B3 DNA binding domain
PROSITE profilePS5086313.817361456IPR003340B3 DNA binding domain
SMARTSM010193.7E-24361456IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.1E-17494587IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-17501587IPR015300DNA-binding pseudobarrel domain
CDDcd100178.83E-15503590No hitNo description
PROSITE profilePS5086310.165504599IPR003340B3 DNA binding domain
PfamPF023621.4E-14504586IPR003340B3 DNA binding domain
SMARTSM010191.9E-20504597IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MVLNLSDFGP CYYENRDLPA PGSNNDQDKT GWTSFCDENG KKAGSVFVFK LVGNRETPVL  60
SFCSTESVND GTQGDKNNKE NCVQLERKQK RMRCKNSTLP SQNRFVTLTL THNNFRKCRQ  120
YLPLSFLRKN GLDKPGMITL LGKAGMKWRA SLKREANGSM VLGKGWKDFV NANGLTSGIS  180
FTLEAISEKG TPMLSLFSTQ STSERSQRRA SMNRVVTLTL THTNLIKSRQ YLPLSFTRAN  240
GLDKPGLITL VGEDGAKWEA NLLRGKTGIM CLGKGWKHFS RANSIKCGES FTLKAILENG  300
TPMLSLCSTQ STSDRSQQGE CSKDSEKESI LAGDSSGKET RKAKDKIEGR RDSLPASMNR  360
FVTLTLRHDN LITGRRYLPF SFTRENGLDK PGKINLIGKD GTKWEANIGR GKTGVMCIGE  420
GWKDFAIASG LKSGESFTLE AIMENGTPML SLFSTEATSG RSQQGERCKD SEKGSISAEP  480
TRGNKATSNR EERTDSSSAI RNRFVTLTLT PEDVSDCKLI IPSQFMKANG INKLGKITIL  540
GQHRMKCFAY ILSKDGFVAL GSGWKGFCEA NGVKIGDSFT LECIVNKTQL LCLSSVPTP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417224.10.0PREDICTED: B3 domain-containing protein REM12-like
TrEMBLD7LIB40.0D7LIB4_ARALL; Predicted protein
STRINGAl_scaffold_0004_4880.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.11e-124B3 family protein